Back to shop
Tesamorelin
$63.00
A growth-hormone-releasing hormone (GHRH) analog studied for visceral-fat and GH-axis research.
For research use only — not for human or veterinary consumption.
Technical Specifications
- CAS Number
- 218949-48-5
- Formula
- C221H366N72O67S
- Molecular Weight
- 5135.9 g/mol
- Sequence
- YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL (N-terminal trans-3-hexenoyl)
- Purity Target
- ≥99% (HPLC)
- Appearance
- White lyophilized powder
- Vial Size
- 20 mg
- Solubility
- Soluble in bacteriostatic water and sterile water.
- Storage
- Lyophilized: store at -20 C, protected from light. Reconstituted: 2-8 C, use within 28 days.
- Handling
- For laboratory research use only. Handle aseptically and avoid repeated freeze-thaw cycles.
