Back to shop
Sermorelin
$59.00
A GHRH (1-29) analog studied for growth-hormone-release and anti-aging research.
For research use only — not for human or veterinary consumption.
Technical Specifications
- CAS Number
- 86168-78-7
- Formula
- C149H246N44O42S
- Molecular Weight
- 3358.0 g/mol
- Sequence
- YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH2 (GHRH 1-29)
- Purity Target
- ≥99% (HPLC)
- Appearance
- White lyophilized powder
- Vial Size
- 20 mg
- Solubility
- Soluble in bacteriostatic water and sterile water.
- Storage
- Lyophilized: store at -20 C, protected from light. Reconstituted: 2-8 C, use within 28 days.
- Handling
- For laboratory research use only. Handle aseptically and avoid repeated freeze-thaw cycles.
