LL-37
CAS 154947-66-7$247.00
LL-37
CAS 154947-66-7$247.00
- Crypto: save 10%
- Venmo: save 5%
- Zelle: save 5%
- Cash App: save 5%
A human cathelicidin antimicrobial peptide studied for immune-defense and skin research.
For research use only — not for human or veterinary consumption.
- Ships fast from the US
- Batch number on every vial
- ≥99% HPLC purity target
Before ordering
- For laboratory research use only — not for human or veterinary use.
- Every vial carries a batch number (see Batch Information below).
- Read the Shipping Policy and Refund Policy before ordering.
Technical Specifications
- CAS Number
- 154947-66-7
- Formula
- C205H340N60O53
- Molecular Weight
- 4493.3 g/mol
- Sequence
- LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES
- Purity Target
- ≥99% (HPLC)
- Appearance
- White lyophilized powder
- Vial Size
- 20 mg
- Solubility
- Soluble in bacteriostatic water and sterile water.
- Storage
- Lyophilized: store at -20 C, protected from light. Reconstituted: 2-8 C, use within 28 days.
- Handling
- For laboratory research use only. Handle aseptically and avoid repeated freeze-thaw cycles.
Why RGP
We're deliberately not the cheapest vial on the market. Every batch is manufactured to a ≥99% HPLC purity target, batch-tracked from manufacture to your bench, and shipped fast from the US with full specifications on record. Independent third-party testing is underway — results will be published here as they come in.
