Back to shop
LL-37
$73.00
A human cathelicidin antimicrobial peptide studied for immune-defense and skin research.
For research use only — not for human or veterinary consumption.
Technical Specifications
- CAS Number
- 154947-66-7
- Formula
- C205H340N60O53
- Molecular Weight
- 4493.3 g/mol
- Sequence
- [LL-37, 37 aa]
- Purity Target
- ≥99% (HPLC)
- Appearance
- White lyophilized powder
- Vial Size
- 20 mg
- Solubility
- Soluble in bacteriostatic water and sterile water.
- Storage
- Lyophilized: store at -20 C, protected from light. Reconstituted: 2-8 C, use within 28 days.
- Handling
- For laboratory research use only. Handle aseptically and avoid repeated freeze-thaw cycles.
